17:03 BAUPROJEKTE

Tunnelbohr-Wettbewerb: Wer schlägt für Elon Musk die Schnecke?

Teaserbild-Quelle: Error420, Unsplash

Elon Musk sucht eine effiziente Tunnelbohr-Technologie für das Tunnelnetz seines Hyperloop und hat dazu ein Wettbewerb ausgeschrieben. Von den insgesamt 400 Einreichungen schafften es zwölf ins Final. Mit dabei ist auch der Vorschlag eines Teams der ETH.

2106_schnecke

Quelle: Error420, Unsplash

Schnelle Schnecke: Sie ist zehn Mal schneller unterwegs als eine Tunnelbohrmaschine.

Mit 1200 Stundenkilometern innert Sekunden oder Minuten von A nach B düsen – das will Elon Musk mit dem Hyperloop ermöglichen. Das Hochgeschwindigkeitsverkehrssystem, das vom Prinzip her an eine Rohrpost erinnert, braucht eine entsprechende Infrastruktur. Oder vielmehr ein Netzwerk aus Tunnels. Damit ein solches möglichst kostengünstig und in nützlicher Frist gebaut werden kann, braucht es eine Tunnelbohrmaschine (TBM), die sich äusserst präzise und schnell durch den Grund fräst.

Mit der „Not a boring Competition“ sucht Musk mit seinem für den Hyperloop gegründeten Tunnelbau-Unternehmen Boring Company nun nach einer solchen TBM-Technologie und fragt die Teilnehmer: „Können Sie die Schnecke schlagen?“ Schnecken sind aktuell (noch) zehn Mal schneller unterwegs als eine TBM. - Der Wettbewerb richtet sich an Studenten, Unternehmen, Hobbykonstrukteure und andere Interessierte.

400 Vorschläge, zwölf Finalisten

Insgesamt haben sich rund 400 Teams mit Vorschlägen beworben. Mittlerweile steht fest, wer es ins  Final geschafft hat. Unter den insgesamt zwölf Finalisten befindet sich auch ein Team der ETH Zürich neben unter anderem der TU München oder dem Massachusetts Institute of Technology. Auch jeweils ein Team von Hobbykonstrukteuren aus England und den Vereinigten Staaten hat es geschafft.

Diesen Sommer sollen die Teams mit den besten Lösungen, zeigen wie diese in der Praxis funktionieren, indem sie einen 30 Meter langen Tunnel von einem Durchmesser eines halben Meters bauen. Sieger werden in drei Kategorien erkoren:

  1. Der Tunnel, der am schnellsten fertig gestellt wurde
  2. Der Tunnel, dessen Fahrfläche um schnellsten befahren werden kann (als Testfahrzeug dient ein ferngesteuerter Tesla)
  3. Der Tunnel mit dem exaktesten Leitsystem

(mai)

Linktipp: www.boringcompany.com

Anzeige

Dossier

Interview-Serie «Chefsache»
© fill / pixabay.com / public domain ähnlich

Interview-Serie «Chefsache»

In der Interview-Serie «Chefsache» nehmen bekannte Exponenten der Bauwirtschaft in loser Folge Stellung zu Fragen rund um das Thema Führung. Alle Teilnehmer erhalten die gleichen 20 Fragen, von denen sie zwölf auswählen und schriftlich beantworten können.

Newsletter abonnieren

Mit dem Baublatt-Newsletter erhalten Sie regelmässig relevante, unabhängige News zu aktuellen Themen der Baubranche.